| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Heme oxygenase 1 |
|---|
| Ligand | BDBM31663 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1733252 |
|---|
| IC50 | 2100±n/a nM |
|---|
| Citation |  Salerno, L; Amata, E; Romeo, G; Marrazzo, A; Prezzavento, O; Floresta, G; Sorrenti, V; Barbagallo, I; Rescifina, A; Pittalą, V Potholing of the hydrophobic heme oxygenase-1 western region for the search of potent and selective imidazole-based inhibitors. Eur J Med Chem148:54-62 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Heme oxygenase 1 |
|---|
| Name: | Heme oxygenase 1 |
|---|
| Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33005.15 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
|---|
| Residue: | 289 |
|---|
| Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
|---|
| BDBM31663 |
|---|
| n/a |
|---|
| Name | BDBM31663 |
|---|
| Synonyms: | imidazole-dioxolane, 15 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H21ClF3N3O2S |
|---|
| Mol. Mass. | 483.934 |
|---|
| SMILES | FC(F)(F)c1ccc(SC[C@@H]2CO[C@@](CCc3ccc(Cl)cc3)(Cn3ccnc3)O2)nc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
