Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 4 |
---|
Ligand | BDBM50369884 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1737219 (CHEMBL4152969) |
---|
Ki | 2.0±n/a nM |
---|
Citation | Chiaramonte, N; Bua, S; Ferraroni, M; Nocentini, A; Bonardi, A; Bartolucci, G; Durante, M; Lucarini, L; Chiapponi, D; Dei, S; Manetti, D; Teodori, E; Gratteri, P; Masini, E; Supuran, CT; Romanelli, MN 2-Benzylpiperazine: A new scaffold for potent human carbonic anhydrase inhibitors. Synthesis, enzyme inhibition, enantioselectivity, computational and crystallographic studies and in vivo activity for a new class of intraocular pressure lowering agents. Eur J Med Chem151:363-375 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 4 |
---|
Name: | Carbonic anhydrase 4 |
Synonyms: | CA-IV | CA4 | CAH4_HUMAN | Carbonate dehydratase IV | Carbonic anhydrase | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV) |
Type: | Enzyme |
Mol. Mass.: | 35037.98 |
Organism: | Homo sapiens (Human) |
Description: | P22748 |
Residue: | 312 |
Sequence: | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
|
|
|
BDBM50369884 |
---|
n/a |
---|
Name | BDBM50369884 |
Synonyms: | CHEMBL4172413 |
Type | Small organic molecule |
Emp. Form. | C19H23N3O5S2 |
Mol. Mass. | 437.533 |
SMILES | CS(=O)(=O)N1CCN([C@H](Cc2ccccc2)C1)C(=O)c1ccc(cc1)S(N)(=O)=O |r| |
Structure |
|