| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 4 |
|---|
| Ligand | BDBM50369730 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1737219 (CHEMBL4152969) |
|---|
| Ki | 2.3±n/a nM |
|---|
| Citation |  Chiaramonte, N; Bua, S; Ferraroni, M; Nocentini, A; Bonardi, A; Bartolucci, G; Durante, M; Lucarini, L; Chiapponi, D; Dei, S; Manetti, D; Teodori, E; Gratteri, P; Masini, E; Supuran, CT; Romanelli, MN 2-Benzylpiperazine: A new scaffold for potent human carbonic anhydrase inhibitors. Synthesis, enzyme inhibition, enantioselectivity, computational and crystallographic studies and in vivo activity for a new class of intraocular pressure lowering agents. Eur J Med Chem151:363-375 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 4 |
|---|
| Name: | Carbonic anhydrase 4 |
|---|
| Synonyms: | CA-IV | CA4 | CAH4_HUMAN | Carbonate dehydratase IV | Carbonic anhydrase | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 35037.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P22748 |
|---|
| Residue: | 312 |
|---|
| Sequence: | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
|
|
|
|---|
| BDBM50369730 |
|---|
| n/a |
|---|
| Name | BDBM50369730 |
|---|
| Synonyms: | CHEMBL4164109 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27N3O3S |
|---|
| Mol. Mass. | 449.565 |
|---|
| SMILES | NS(=O)(=O)c1ccc(cc1)C(=O)N1CCN(Cc2ccccc2)[C@H](Cc2ccccc2)C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
