Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18512 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1747395 (CHEMBL4181905) |
---|
IC50 | 140±n/a nM |
---|
Citation | Patel, TS; Bhatt, JD; Vanparia, SF; Patel, UH; Dixit, RB; Chudasama, CJ; Patel, BD; Dixit, BC Ionic liquid mediated stereoselective synthesis of alanine linked hybrid quinazoline-4(3H)-one derivatives perturbing the malarial reductase activity in folate pathway. Bioorg Med Chem25:6635-6646 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
Type: | Enzyme |
Mol. Mass.: | 21603.71 |
Organism: | Bos taurus (Cattle) |
Description: | P00376 |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
BDBM18512 |
---|
n/a |
---|
Name | BDBM18512 |
Synonyms: | 5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine | CHEMBL36 | Pyrimethamine (Pyr) | US11530198, Example Pyrimethamine | cid_4993 |
Type | Small organic molecule |
Emp. Form. | C12H13ClN4 |
Mol. Mass. | 248.711 |
SMILES | CCc1nc(N)nc(N)c1-c1ccc(Cl)cc1 |
Structure |
|