| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribonuclease P protein component |
|---|
| Ligand | BDBM50455315 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1754176 (CHEMBL4188936) |
|---|
| IC50 | 20000±n/a nM |
|---|
| Citation |  Lounsbury, N; Eidem, T; Colquhoun, J; Mateo, G; Abou-Gharbia, M; Dunman, PM; Childers, WE Novel inhibitors of Staphylococcus aureus RnpA that synergize with mupirocin. Bioorg Med Chem Lett28:1127-1131 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribonuclease P protein component |
|---|
| Name: | Ribonuclease P protein component |
|---|
| Synonyms: | 3.1.26.5 | Protein C5 | RNPA_STAAU | RNase P protein | RNaseP protein | Ribonuclease P protein component | rnpA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13673.76 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | ChEMBL_117955 |
|---|
| Residue: | 117 |
|---|
| Sequence: | MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRN
KIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
|
|
|
|---|
| BDBM50455315 |
|---|
| n/a |
|---|
| Name | BDBM50455315 |
|---|
| Synonyms: | CHEMBL4207799 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H21N3O4S |
|---|
| Mol. Mass. | 375.442 |
|---|
| SMILES | CC(C)c1ccc(OCC(=O)NNC(=S)NC(=O)c2occc2C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
