| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50199883 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1754206 (CHEMBL4188966) |
|---|
| IC50 | 3500±n/a nM |
|---|
| Citation |  Goel, P; Jumpertz, T; Tichá, A; Ogorek, I; Mikles, DC; Hubalek, M; Pietrzik, CU; Strisovsky, K; Schmidt, B; Weggen, S Discovery and validation of 2-styryl substituted benzoxazin-4-ones as a novel scaffold for rhomboid protease inhibitors. Bioorg Med Chem Lett28:1417-1422 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50199883 |
|---|
| n/a |
|---|
| Name | BDBM50199883 |
|---|
| Synonyms: | 3,4‐Dichloroisocoumarin (2) | 3,4-Dichloro-isochromen-1-one | 3,4-dichloro-1H-isochromen-1-one | 3,4-dichloroisocoumarin | CHEMBL24983 | cid_1609 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H4Cl2O2 |
|---|
| Mol. Mass. | 215.033 |
|---|
| SMILES | Clc1oc(=O)c2ccccc2c1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
