Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 17 |
---|
Ligand | BDBM25525 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1756639 (CHEMBL4191647) |
---|
IC50 | 12000±n/a nM |
---|
Citation | Bodle, CR; Mackie, DI; Hayes, MP; Schamp, JH; Miller, MR; Henry, MD; Doorn, JA; Houtman, JCD; James, MA; Roman, DL Natural Products Discovered in a High-Throughput Screen Identified as Inhibitors of RGS17 and as Cytostatic and Cytotoxic Agents for Lung and Prostate Cancer Cell Lines. J Nat Prod80:1992-2000 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Regulator of G-protein signaling 17 |
---|
Name: | Regulator of G-protein signaling 17 |
Synonyms: | RGS17 | RGS17_HUMAN | RGSZ2 |
Type: | PROTEIN |
Mol. Mass.: | 24356.71 |
Organism: | Homo sapiens |
Description: | ChEMBL_118219 |
Residue: | 210 |
Sequence: | MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
|
|
|
BDBM25525 |
---|
n/a |
---|
Name | BDBM25525 |
Synonyms: | 24-methyl-5,7,18,20-tetraoxa-24-azahexacyclo[11.11.0.0^{2,10}.0^{4,8}.0^{14,22}.0^{17,21}]tetracosa-1(13),2,4(8),9,11,14(22),15,17(21),23-nonaen-24-ium | CHEMBL490129 | Pseudochelerythrine | Veadent | cid_5154 | sanguinarine | sangvinarin |
Type | Small organic molecule |
Emp. Form. | C20H14NO4 |
Mol. Mass. | 332.3289 |
SMILES | C[n+]1cc2c3OCOc3ccc2c2ccc3cc4OCOc4cc3c12 |
Structure |
|