| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 17 |
|---|
| Ligand | BDBM50456401 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1756642 (CHEMBL4191650) |
|---|
| IC50 | 47200±n/a nM |
|---|
| Citation |  Bodle, CR; Mackie, DI; Hayes, MP; Schamp, JH; Miller, MR; Henry, MD; Doorn, JA; Houtman, JCD; James, MA; Roman, DL Natural Products Discovered in a High-Throughput Screen Identified as Inhibitors of RGS17 and as Cytostatic and Cytotoxic Agents for Lung and Prostate Cancer Cell Lines. J Nat Prod80:1992-2000 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Regulator of G-protein signaling 17 |
|---|
| Name: | Regulator of G-protein signaling 17 |
|---|
| Synonyms: | RGS17 | RGS17_HUMAN | RGSZ2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24356.71 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_118219 |
|---|
| Residue: | 210 |
|---|
| Sequence: | MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
|
|
|
|---|
| BDBM50456401 |
|---|
| n/a |
|---|
| Name | BDBM50456401 |
|---|
| Synonyms: | IRIGENOL |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10O8 |
|---|
| Mol. Mass. | 318.2351 |
|---|
| SMILES | Oc1cc(cc(O)c1O)-c1coc2cc(O)c(O)c(O)c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
