Reaction Details |
| Report a problem with these data |
Target | Cytosol aminopeptidase [33-68,L62W] |
---|
Ligand | BDBM50457473 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1759783 (CHEMBL4194791) |
---|
IC50 | 30±n/a nM |
---|
Citation | Amin, SA; Adhikari, N; Jha, T Design of Aminopeptidase N Inhibitors as Anti-cancer Agents. J Med Chem61:6468-6490 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytosol aminopeptidase [33-68,L62W] |
---|
Name: | Cytosol aminopeptidase [33-68,L62W] |
Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
Type: | Enzyme |
Mol. Mass.: | 4015.44 |
Organism: | Sus scrofa (Pig) |
Description: | P28839[33-68,L62W] |
Residue: | 36 |
Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
BDBM50457473 |
---|
n/a |
---|
Name | BDBM50457473 |
Synonyms: | CHEMBL4209822 |
Type | Small organic molecule |
Emp. Form. | C16H22N2O6 |
Mol. Mass. | 338.3557 |
SMILES | CC(C)C[C@@H]([C@H](O)C(=O)NO)C(=O)N[C@H](C(O)=O)c1ccccc1 |r| |
Structure |
|