| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Ligand | BDBM50457473 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1759783 (CHEMBL4194791) |
|---|
| IC50 | 30±n/a nM |
|---|
| Citation |  Amin, SA; Adhikari, N; Jha, T Design of Aminopeptidase N Inhibitors as Anti-cancer Agents. J Med Chem61:6468-6490 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytosol aminopeptidase [33-68,L62W] |
|---|
| Name: | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 4015.44 |
|---|
| Organism: | Sus scrofa (Pig) |
|---|
| Description: | P28839[33-68,L62W] |
|---|
| Residue: | 36 |
|---|
| Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
|---|
| BDBM50457473 |
|---|
| n/a |
|---|
| Name | BDBM50457473 |
|---|
| Synonyms: | CHEMBL4209822 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H22N2O6 |
|---|
| Mol. Mass. | 338.3557 |
|---|
| SMILES | CC(C)C[C@@H]([C@H](O)C(=O)NO)C(=O)N[C@H](C(O)=O)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
