| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587,G537V,H558K,V571A] |
|---|
| Ligand | BDBM50067593 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1772762 (CHEMBL4229754) |
|---|
| Ki | 0.380000±n/a nM |
|---|
| Citation |  Ramesh, R; Reddy, DS Quest for Novel Chemical Entities through Incorporation of Silicon in Drug Scaffolds. J Med Chem61:3779-3798 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587,G537V,H558K,V571A] |
|---|
| Name: | Gag-Pol polyprotein [489-587,G537V,H558K,V571A] |
|---|
| Synonyms: | HIV-1 protease | HIV-1 protease (G48V) | HIV-1 protease (V82A) | POL_HV1N5 | gag-pol |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 10827.77 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | P12497[489-587,G537V,H558K,V571A] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50067593 |
|---|
| n/a |
|---|
| Name | BDBM50067593 |
|---|
| Synonyms: | CHEBI:44032 | Crixivan | Indinavir | L-735524 | MK-639 | US10806794, Compound Indinavir |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H47N5O4 |
|---|
| Mol. Mass. | 613.7895 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@@H]1CN(Cc2cccnc2)CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
