Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen B |
---|
Ligand | BDBM50024093 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_216619 (CHEMBL819191) |
---|
Ki | 55000±n/a nM |
---|
Citation | Sofia, MJ; Katzenellenbogen, JA Enol lactone inhibitors of serine proteases. The effect of regiochemistry on the inactivation behavior of phenyl-substituted (halomethylene)tetra- and -dihydrofuranones and (halomethylene)tetrahydropyranones toward alpha-chymotrypsin: stable acyl enzyme intermediate. J Med Chem29:230-8 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen B |
---|
Name: | Chymotrypsinogen B |
Synonyms: | Beta-chymotrypsin | CTRB | CTRB1 | CTRB1_HUMAN | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB |
Type: | PROTEIN |
Mol. Mass.: | 27713.98 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_10909 |
Residue: | 263 |
Sequence: | MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
BDBM50024093 |
---|
n/a |
---|
Name | BDBM50024093 |
Synonyms: | 6-Iodomethylene-5-phenyl-tetrahydro-pyran-2-one | CHEMBL310682 |
Type | Small organic molecule |
Emp. Form. | C12H11IO2 |
Mol. Mass. | 314.119 |
SMILES | I\C=C1\OC(=O)CCC1c1ccccc1 |
Structure |
|