| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen B |
|---|
| Ligand | BDBM50024092 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_216620 (CHEMBL819192) |
|---|
| Ki | 5.3±n/a nM |
|---|
| Citation |  Sofia, MJ; Katzenellenbogen, JA Enol lactone inhibitors of serine proteases. The effect of regiochemistry on the inactivation behavior of phenyl-substituted (halomethylene)tetra- and -dihydrofuranones and (halomethylene)tetrahydropyranones toward alpha-chymotrypsin: stable acyl enzyme intermediate. J Med Chem29:230-8 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen B |
|---|
| Name: | Chymotrypsinogen B |
|---|
| Synonyms: | Beta-chymotrypsin | CTRB | CTRB1 | CTRB1_HUMAN | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27713.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_10909 |
|---|
| Residue: | 263 |
|---|
| Sequence: | MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
|---|
| BDBM50024092 |
|---|
| n/a |
|---|
| Name | BDBM50024092 |
|---|
| Synonyms: | 6-Iodomethylene-4-phenyl-tetrahydro-pyran-2-one | CHEMBL307448 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H11IO2 |
|---|
| Mol. Mass. | 314.119 |
|---|
| SMILES | I\C=C1/CC(CC(=O)O1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
