| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type quorum-sensing regulator RhlR |
|---|
| Ligand | BDBM50465702 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1788578 (CHEMBL4260312) |
|---|
| IC50 | 8000±n/a nM |
|---|
| Citation |  Soukarieh, F; Williams, P; Stocks, MJ; Cámara, M Pseudomonas aeruginosa Quorum Sensing Systems as Drug Discovery Targets: Current Position and Future Perspectives. J Med Chem61:10385-10402 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type quorum-sensing regulator RhlR |
|---|
| Name: | HTH-type quorum-sensing regulator RhlR |
|---|
| Synonyms: | Elastase modulator | RHLR_PSEAE | Regulatory protein RhlR | lasM | rhlR | vsmR | vsmR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27579.79 |
|---|
| Organism: | Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG12228) |
|---|
| Description: | ChEMBL_108034 |
|---|
| Residue: | 241 |
|---|
| Sequence: | MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEV
HGTYPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWSDSLFDQSRMLWNEARDWGLCVGA
TLPIRAPNNLLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVC
LSHREREILQWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGL
I
|
|
|
|---|
| BDBM50465702 |
|---|
| n/a |
|---|
| Name | BDBM50465702 |
|---|
| Synonyms: | CHEMBL4292339 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H18BrNO3S |
|---|
| Mol. Mass. | 372.277 |
|---|
| SMILES | Brc1cccc(OCCCCC(=O)NC2CCSC2=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
