| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, adipocyte |
|---|
| Ligand | BDBM50468371 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1799370 (CHEMBL4271662) |
|---|
| Ki | 210±n/a nM |
|---|
| Citation |  Gao, DD; Dou, HX; Su, HX; Zhang, MM; Wang, T; Liu, QF; Cai, HY; Ding, HP; Yang, Z; Zhu, WL; Xu, YC; Wang, HY; Li, YX From hit to lead: Structure-based discovery of naphthalene-1-sulfonamide derivatives as potent and selective inhibitors of fatty acid binding protein 4. Eur J Med Chem154:44-59 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, adipocyte |
|---|
| Name: | Fatty acid-binding protein, adipocyte |
|---|
| Synonyms: | A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | FABP4 | FABP4_HUMAN | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4 | Fatty acid-binding protein 4 (FABP4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 14719.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P15090 |
|---|
| Residue: | 132 |
|---|
| Sequence: | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
|
|
|
|---|
| BDBM50468371 |
|---|
| n/a |
|---|
| Name | BDBM50468371 |
|---|
| Synonyms: | CHEMBL4283424 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H14FNO5S |
|---|
| Mol. Mass. | 375.371 |
|---|
| SMILES | COc1ccc(c2ccccc12)S(=O)(=O)Nc1ccc(F)c(c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
