| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50139772 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_211324 (CHEMBL818983) |
|---|
| IC50 | 1800±n/a nM |
|---|
| Citation |  Poncet, J; Busquet, M; Roux, F; Pierré, A; Atassi, G; Jouin, P Synthesis and biological activity of chimeric structures derived from the cytotoxic natural compounds dolastatin 10 and dolastatin 15. J Med Chem41:1524-30 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50139772 |
|---|
| n/a |
|---|
| Name | BDBM50139772 |
|---|
| Synonyms: | 22-oxovincaleukoblastine | leurocristine | vincristine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H56N4O10 |
|---|
| Mol. Mass. | 824.9576 |
|---|
| SMILES | CC[C@]1(O)C[C@H]2CN(C1)CCc1c([nH]c3ccccc13)[C@@](C2)(C(=O)OC)c1cc2c(cc1OC)N(C=O)[C@@H]1[C@]22CCN3CC=C[C@](CC)([C@@H]23)[C@@H](OC(C)=O)[C@]1(O)C(=O)OC |r,c:49| |
|---|
| Structure | 
|
|---|
Search and Browse
