Reaction Details |
| Report a problem with these data |
Target | Leukotriene B4 receptor 2 |
---|
Ligand | BDBM50472425 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_99657 (CHEMBL704423) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Poudrel, JM; Hullot, P; Vidal, JP; Girard, JP; Rossi, JC; Muller, A; Bonne, C; Bezuglov, V; Serkov, I; Renard, P; Pfeiffer, B Synthesis and structure-activity relationships of new 1, 3-disubstituted cyclohexanes as structurally rigid leukotriene B(4) receptor antagonists. J Med Chem42:5289-310 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Leukotriene B4 receptor 2 |
---|
Name: | Leukotriene B4 receptor 2 |
Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 37964.86 |
Organism: | Homo sapiens (Human) |
Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
Residue: | 358 |
Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
BDBM50472425 |
---|
n/a |
---|
Name | BDBM50472425 |
Synonyms: | CHEMBL149002 |
Type | Small organic molecule |
Emp. Form. | C24H37NO3 |
Mol. Mass. | 387.5555 |
SMILES | CN(C)C(=O)C[C@]1(O)CCC[C@@H](C1)\C=C\C(C)(O)CCCCc1ccccc1 |
Structure |
|