| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 2 |
|---|
| Ligand | BDBM50472426 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_99657 (CHEMBL704423) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Poudrel, JM; Hullot, P; Vidal, JP; Girard, JP; Rossi, JC; Muller, A; Bonne, C; Bezuglov, V; Serkov, I; Renard, P; Pfeiffer, B Synthesis and structure-activity relationships of new 1, 3-disubstituted cyclohexanes as structurally rigid leukotriene B(4) receptor antagonists. J Med Chem42:5289-310 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 2 |
|---|
| Name: | Leukotriene B4 receptor 2 |
|---|
| Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37964.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
|---|
| BDBM50472426 |
|---|
| n/a |
|---|
| Name | BDBM50472426 |
|---|
| Synonyms: | CHEMBL150746 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H33NaO4 |
|---|
| Mol. Mass. | 348.4527 |
|---|
| SMILES | [Na;v0+].[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6](-[#8])\[#6]=[#6]\[#6@H]-1-[#6]-[#6]-[#6][C@]([#8])([#6]-[#6](-[#8-])=O)[#6]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
