| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, intestinal |
|---|
| Ligand | BDBM50152850 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_68775 (CHEMBL684424) |
|---|
| Kd | 3715±n/a nM |
|---|
| Citation |  Ishchenko, AV; Shakhnovich, EI SMall Molecule Growth 2001 (SMoG2001): an improved knowledge-based scoring function for protein-ligand interactions. J Med Chem45:2770-80 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, intestinal |
|---|
| Name: | Fatty acid-binding protein, intestinal |
|---|
| Synonyms: | FABP2 | FABPI | FABPI_HUMAN | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP | Intestinal fatty acid-binding protein (hIFABP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 15207.56 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 132 |
|---|
| Sequence: | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
|
|
|
|---|
| BDBM50152850 |
|---|
| n/a |
|---|
| Name | BDBM50152850 |
|---|
| Synonyms: | 1-HEXYLDECANOIC ACID | CHEMBL82293 | Hexadecanoic acid | Hexadecanoic acid anion | Palmitic acid (PA) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H32O2 |
|---|
| Mol. Mass. | 256.4241 |
|---|
| SMILES | CCCCCCCCCCCCCCCC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
