| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Substance-K receptor |
|---|
| Ligand | BDBM50476231 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_430641 (CHEMBL918150) |
|---|
| Ki | 0.158489±n/a nM |
|---|
| Citation |  Fedi, V; Altamura, M; Balacco, G; Canfarini, F; Criscuoli, M; Giannotti, D; Giolitti, A; Giuliani, S; Guidi, A; Harmat, NJ; Nannicini, R; Pasqui, F; Patacchini, R; Perrotta, E; Tramontana, M; Triolo, A; Maggi, CA Insertion of an aspartic acid moiety into cyclic pseudopeptides: synthesis and biological characterization of potent antagonists for the human Tachykinin NK-2 receptor. J Med Chem47:6935-47 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Substance-K receptor |
|---|
| Name: | Substance-K receptor |
|---|
| Synonyms: | NK-2 receptor | NK-2R | NK2R | NK2R_HUMAN | NKNAR | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | TAC2R | TACR2 | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2) | hnk-3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 44455.78 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21452 |
|---|
| Residue: | 398 |
|---|
| Sequence: | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
|
|
|
|---|
| BDBM50476231 |
|---|
| n/a |
|---|
| Name | BDBM50476231 |
|---|
| Synonyms: | CHEMBL225588 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H54N8O6 |
|---|
| Mol. Mass. | 790.9496 |
|---|
| SMILES | O=C(CN1CCC(CC1)N1CCOCC1)N[C@@H]1CC(=O)N[C@@H](Cc2c[nH]c3ccccc23)C(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@H](Cc2ccccc2)CNC1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
