| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50478563 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_483709 (CHEMBL954608) |
|---|
| IC50 | 6000±n/a nM |
|---|
| Citation |  Patil, AD; Kokke, WC; Cochran, S; Francis, TA; Tomszek, T; Westley, JW Brominated polyacetylenic acids from the marine sponge Xestospongia muta: inhibitors of HIV protease. J Nat Prod55:1170-7 (1992) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50478563 |
|---|
| n/a |
|---|
| Name | BDBM50478563 |
|---|
| Synonyms: | CHEMBL450380 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H17BrO2 |
|---|
| Mol. Mass. | 345.23 |
|---|
| SMILES | OC(=O)CCCC#CC#C\C=C\CC\C=C\C#C\C=C\Br |
|---|
| Structure | 
|
|---|
Search and Browse
