Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50067593 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_469364 (CHEMBL933047) |
---|
Ki | 0.520000±n/a nM |
---|
Citation | Wu, X; Ohrngren, P; Ekegren, JK; Unge, J; Unge, T; Wallberg, H; Samuelsson, B; Hallberg, A; Larhed, M Two-carbon-elongated HIV-1 protease inhibitors with a tertiary-alcohol-containing transition-state mimic. J Med Chem51:1053-7 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50067593 |
---|
n/a |
---|
Name | BDBM50067593 |
Synonyms: | CHEBI:44032 | Crixivan | Indinavir | L-735524 | MK-639 | US10806794, Compound Indinavir |
Type | Small organic molecule |
Emp. Form. | C36H47N5O4 |
Mol. Mass. | 613.7895 |
SMILES | CC(C)(C)NC(=O)[C@@H]1CN(Cc2cccnc2)CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |r| |
Structure |
|