| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50011181 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_508433 (CHEMBL1001303) |
|---|
| Kd | 400±n/a nM |
|---|
| Citation |  Marchand, B; Tchesnokov, EP; Götte, M The pyrophosphate analogue foscarnet traps the pre-translocational state of HIV-1 reverse transcriptase in a Brownian ratchet model of polymerase translocation. J Biol Chem282:3337-46 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50011181 |
|---|
| n/a |
|---|
| Name | BDBM50011181 |
|---|
| Synonyms: | (PFA)dihydroxyphosphinecarboxylic acid oxide | CHEMBL666 | FOSCARNET | Forscarnet | Foscarnet (PFA) | Foscavir | Phosphono-formic acid(PFA) | Phosphonoformate | dihydroxyphosphinecarboxylic acid oxide | dihydroxyphosphinecarboxylic acid oxide(PFA) | phosphonoformic acid(PFA) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | CH3O5P |
|---|
| Mol. Mass. | 126.0053 |
|---|
| SMILES | OC(=O)P(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
