| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM33410 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_561275 (CHEMBL1016223) |
|---|
| IC50 | 6320±n/a nM |
|---|
| Citation |  Billamboz, M; Bailly, F; Barreca, ML; De Luca, L; Mouscadet, JF; Calmels, C; Andréola, ML; Witvrouw, M; Christ, F; Debyser, Z; Cotelle, P Design, synthesis, and biological evaluation of a series of 2-hydroxyisoquinoline-1,3(2H,4H)-diones as dual inhibitors of human immunodeficiency virus type 1 integrase and the reverse transcriptase RNase H domain. J Med Chem51:7717-30 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM33410 |
|---|
| n/a |
|---|
| Name | BDBM33410 |
|---|
| Synonyms: | CHEMBL16755 | N-hydroxyisoquinolinedione, 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H7NO3 |
|---|
| Mol. Mass. | 177.1568 |
|---|
| SMILES | ON1C(=O)Cc2ccccc2C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
