| Reaction Details |
|---|
 | Report a problem with these data |
| Target | DNA-binding transcriptional activator DevR/DosR |
|---|
| Ligand | BDBM50480870 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_591894 (CHEMBL1045964) |
|---|
| IC50 | 295000±n/a nM |
|---|
| Citation |  Gupta, RK; Thakur, TS; Desiraju, GR; Tyagi, JS Structure-based design of DevR inhibitor active against nonreplicating Mycobacterium tuberculosis. J Med Chem52:6324-34 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| DNA-binding transcriptional activator DevR/DosR |
|---|
| Name: | DNA-binding transcriptional activator DevR/DosR |
|---|
| Synonyms: | DEVR_MYCTU | DNA-binding transcriptional activator DevR/DosR | devR | dosR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 23292.23 |
|---|
| Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Description: | ChEMBL_102872 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDG
NGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGA
GRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKT
VKNYVSRLLAKLGMERRTQAAVFATELKRSRPPGDGP
|
|
|
|---|
| BDBM50480870 |
|---|
| n/a |
|---|
| Name | BDBM50480870 |
|---|
| Synonyms: | CHEMBL571713 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H25Cl2NO5 |
|---|
| Mol. Mass. | 490.376 |
|---|
| SMILES | COc1cc(NC(=O)CCc2ccc(OCc3ccc(Cl)cc3)c(OC)c2)c(OC)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
