| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50370655 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_712679 (CHEMBL1660422) |
|---|
| Ki | 1050±n/a nM |
|---|
| Citation |  Yang, G; Paintsil, E; Dutschman, GE; Grill, SP; Wang, CJ; Wang, J; Tanaka, H; Hamasaki, T; Baba, M; Cheng, YC Impact of novel human immunodeficiency virus type 1 reverse transcriptase mutations P119S and T165A on 4'-ethynylthymidine analog resistance profile. Antimicrob Agents Chemother53:4640-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50370655 |
|---|
| n/a |
|---|
| Name | BDBM50370655 |
|---|
| Synonyms: | CHEMBL485652 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H15N2O13P3 |
|---|
| Mol. Mass. | 464.153 |
|---|
| SMILES | Cc1cn([C@@H]2O[C@H](CO[P@@](O)(=O)O[P@@](O)(=O)OP(O)(O)=O)C=C2)c(=O)[nH]c1=O |r,c:21| |
|---|
| Structure | 
|
|---|
Search and Browse
