Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase protein |
---|
Ligand | BDBM50483329 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_712679 (CHEMBL1660422) |
---|
Ki | 730±n/a nM |
---|
Citation | Yang, G; Paintsil, E; Dutschman, GE; Grill, SP; Wang, CJ; Wang, J; Tanaka, H; Hamasaki, T; Baba, M; Cheng, YC Impact of novel human immunodeficiency virus type 1 reverse transcriptase mutations P119S and T165A on 4'-ethynylthymidine analog resistance profile. Antimicrob Agents Chemother53:4640-6 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase protein |
---|
Name: | Reverse transcriptase protein |
Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
Type: | Protein |
Mol. Mass.: | 30203.56 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WJQ2 |
Residue: | 259 |
Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
BDBM50483329 |
---|
n/a |
---|
Name | BDBM50483329 |
Synonyms: | CHEMBL1650290 |
Type | Small organic molecule |
Emp. Form. | C12H17N2O13P3 |
Mol. Mass. | 490.1903 |
SMILES | Cc1cn([C@@H]2O[C@@](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)(C=C)C=C2)c(=O)[nH]c1=O |r,c:23| |
Structure |
|