| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50061306 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_830321 (CHEMBL2060910) |
|---|
| Kd | 38±n/a nM |
|---|
| Citation |  Domínguez, JL; Gossas, T; Carmen Villaverde, M; Helena Danielson, U; Sussman, F Experimental and 'in silico' analysis of the effect of pH on HIV-1 protease inhibitor affinity: implications for the charge state of the protein ionogenic groups. Bioorg Med Chem20:4838-47 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50061306 |
|---|
| n/a |
|---|
| Name | BDBM50061306 |
|---|
| Synonyms: | (3S,4aS,8aS)-2-[(2R,3R)-2-Hydroxy-3-(3-hydroxy-2-methyl-benzoylamino)-4-phenylsulfanyl-butyl]-decahydro-isoquinoline-3-carboxylic acid tert-butylamide; compound with methanesulfonic acid | AG-1343 | CHEMBL1205 | NELFINAVIR MESYLATE | Nelfinavir | Viracept | cmdc.202100576, 24h |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H45N3O4S |
|---|
| Mol. Mass. | 567.782 |
|---|
| SMILES | Cc1c(O)cccc1C(=O)N[C@@H](CSc1ccccc1)[C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
