Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50061306 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_830319 (CHEMBL2060908) |
---|
Kd | 3.4±n/a nM |
---|
Citation | Domínguez, JL; Gossas, T; Carmen Villaverde, M; Helena Danielson, U; Sussman, F Experimental and 'in silico' analysis of the effect of pH on HIV-1 protease inhibitor affinity: implications for the charge state of the protein ionogenic groups. Bioorg Med Chem20:4838-47 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50061306 |
---|
n/a |
---|
Name | BDBM50061306 |
Synonyms: | (3S,4aS,8aS)-2-[(2R,3R)-2-Hydroxy-3-(3-hydroxy-2-methyl-benzoylamino)-4-phenylsulfanyl-butyl]-decahydro-isoquinoline-3-carboxylic acid tert-butylamide; compound with methanesulfonic acid | AG-1343 | CHEMBL1205 | NELFINAVIR MESYLATE | Nelfinavir | Viracept | cmdc.202100576, 24h |
Type | Small organic molecule |
Emp. Form. | C32H45N3O4S |
Mol. Mass. | 567.782 |
SMILES | Cc1c(O)cccc1C(=O)N[C@@H](CSc1ccccc1)[C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C |r| |
Structure |
|