| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50485743 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_858662 (CHEMBL2166544) |
|---|
| Ki | 0.055000±n/a nM |
|---|
| Citation |  Parai, MK; Huggins, DJ; Cao, H; Nalam, MN; Ali, A; Schiffer, CA; Tidor, B; Rana, TM Design, synthesis, and biological and structural evaluations of novel HIV-1 protease inhibitors to combat drug resistance. J Med Chem55:6328-41 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50485743 |
|---|
| n/a |
|---|
| Name | BDBM50485743 |
|---|
| Synonyms: | CHEMBL2165919 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H39N3O7S |
|---|
| Mol. Mass. | 561.69 |
|---|
| SMILES | CC[C@H](C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)OC[C@@H]1CCC(=O)N1)S(=O)(=O)c1ccc(OC)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
