Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50029712 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_64004 (CHEMBL672345) |
---|
Ki | 0.03±n/a nM |
---|
Citation | Hlasta, DJ; Ackerman, JH; Court, JJ; Farrell, RP; Johnson, JA; Kofron, JL; Robinson, DT; Talomie, TG; Dunlap, RP; Franke, CA A novel class of cyclic beta-dicarbonyl leaving groups and their use in the design of benzisothiazolone human leukocyte elastase inhibitors. J Med Chem38:4687-92 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50029712 |
---|
n/a |
---|
Name | BDBM50029712 |
Synonyms: | 2-(4-Chloro-5-oxo-2,5-dihydro-furan-3-yloxymethyl)-4-isopropyl-6-methoxy-1,1-dioxo-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL143819 |
Type | Small organic molecule |
Emp. Form. | C16H16ClNO7S |
Mol. Mass. | 401.819 |
SMILES | COc1cc2c(C(=O)N(COC3=C(Cl)C(=O)OC3)S2(=O)=O)c(c1)C(C)C |c:11| |
Structure |
|