| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18792 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55121 (CHEMBL665447) |
|---|
| IC50 | 110±n/a nM |
|---|
| Citation |  Queener, SF New drug developments for opportunistic infections in immunosuppressed patients: Pneumocystis carinii. J Med Chem38:4739-59 (1996) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM18792 |
|---|
| n/a |
|---|
| Name | BDBM18792 |
|---|
| Synonyms: | 1-(4-chlorophenyl)-6,6-dimethyl-1,6-dihydro-1,3,5-triazine-2,4-diamine | CHEMBL747 | Chlorazin | Cycloguanil |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14ClN5 |
|---|
| Mol. Mass. | 251.715 |
|---|
| SMILES | CC1(C)N=C(N)N=C(N)N1c1ccc(Cl)cc1 |t:3,6| |
|---|
| Structure | 
|
|---|
Search and Browse
