| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50029772 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54946 (CHEMBL669017) |
|---|
| IC50 | 2.1±n/a nM |
|---|
| Citation |  Rosowsky, A; Forsch, RA; Queener, SF 2,4-Diaminopyrido[3,2-d]pyrimidine inhibitors of dihydrofolate reductase from Pneumocystis carinii and Toxoplasma gondii. J Med Chem38:2615-20 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50029772 |
|---|
| n/a |
|---|
| Name | BDBM50029772 |
|---|
| Synonyms: | 5-Methyl-6-[(3,4,5-trimethoxy-phenylamino)-methyl]-pyrido[2,3-d]pyrimidine-2,4-diamine | CHEMBL23532 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N6O3 |
|---|
| Mol. Mass. | 370.4057 |
|---|
| SMILES | COc1cc(NCc2cnc3nc(N)nc(N)c3c2C)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
