| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Juvenile hormone esterase, isoform B |
|---|
| Ligand | BDBM50371971 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_916867 (CHEMBL3082115) |
|---|
| IC50 | 31±n/a nM |
|---|
| Citation |  Wheelock, CE; Severson, TF; Hammock, BD Synthesis of new carboxylesterase inhibitors and evaluation of potency and water solubility. Chem Res Toxicol14:1563-72 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Juvenile hormone esterase, isoform B |
|---|
| Name: | Juvenile hormone esterase, isoform B |
|---|
| Synonyms: | 3.1.1.59 | JH esterase | JHE-B | JHEB_TRINI | Juvenile hormone esterase, isoform B |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 6500.06 |
|---|
| Organism: | Trichoplusia ni |
|---|
| Description: | ChEMBL_106713 |
|---|
| Residue: | 59 |
|---|
| Sequence: | LPSLSADAEAPSKIDTAYYNGTKTAPVYQYQFGVGIELTYVFKGSQYQDIESPTAYQSK
|
|
|
|---|
| BDBM50371971 |
|---|
| n/a |
|---|
| Name | BDBM50371971 |
|---|
| Synonyms: | CHEMBL440542 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H15F3OS |
|---|
| Mol. Mass. | 228.275 |
|---|
| SMILES | CCCCCCSCC(=O)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
