Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18268 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_55140 (CHEMBL668783) |
---|
IC50 | 3±n/a nM |
---|
Citation | Gangjee, A; Zaveri, N; Kothare, M; Queener, SF Nonclassical 2,4-diamino-6-(aminomethyl)-5,6,7,8-tetrahydroquinazoline antifolates: synthesis and biological activities. J Med Chem38:3660-8 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM18268 |
---|
n/a |
---|
Name | BDBM18268 |
Synonyms: | 5-methyl-6-{[(3,4,5-trimethoxyphenyl)amino]methyl}quinazoline-2,4-diamine | CHEMBL119 | TMQ | Trimetrexate | US11111252, Compound TMQ | US11530198, Example Trimetrexate |
Type | Small organic molecule |
Emp. Form. | C19H23N5O3 |
Mol. Mass. | 369.4176 |
SMILES | COc1cc(NCc2ccc3nc(N)nc(N)c3c2C)cc(OC)c1OC |
Structure |
|