| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50036075 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_49452 (CHEMBL659800) |
|---|
| Ki | 26000±n/a nM |
|---|
| Citation |  Veale, CA; Damewood, JR; Steelman, GB; Bryant, C; Gomes, B; Williams, J Non-peptidic inhibitors of human leukocyte elastase. 4. Design, synthesis, and in vitro and in vivo activity of a series of beta-carbolinone-containing trifluoromethyl ketones. J Med Chem38:86-97 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50036075 |
|---|
| n/a |
|---|
| Name | BDBM50036075 |
|---|
| Synonyms: | CHEMBL368630 | {1-Oxo-3-phenyl-2-[(3,3,3-trifluoro-1-isopropyl-2-oxo-propylcarbamoyl)-methyl]-2,9-dihydro-1H-beta-carbolin-8-yl}-phosphonic acid dimethyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27F3N3O6P |
|---|
| Mol. Mass. | 577.4888 |
|---|
| SMILES | COP(=O)(OC)c1cccc2c3cc(-c4ccccc4)n(CC(=O)NC(C(C)C)C(=O)C(F)(F)F)c(O)c3nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
