Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50291916 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_64660 (CHEMBL674812) |
---|
KON | 1.2 M-1s-1 |
---|
Citation | Alpegiani, M; Bissolino, P; Corigli, R; Del Nero, S; Perrone, E; Rizzo, V; Sacchi, N; Cassinelli, G; Franceschi, G; Baici, A Cephem sulfones as inactivators of human leukocyte elastase. 5. 7 alpha-Methoxy- and 7 alpha-chloro-1,1-dioxocephem 4-ketones. J Med Chem37:4003-19 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50291916 |
---|
n/a |
---|
Name | BDBM50291916 |
Synonyms: | (S)-7-Chloro-2-(2,2-dimethyl-propionyl)-3-(1-methyl-1H-tetrazol-5-ylsulfanylmethyl)-5,5-dioxo-5lambda*6*-thia-1-aza-bicyclo[4.2.0]oct-2-en-8-one | CHEMBL128519 |
Type | Small organic molecule |
Emp. Form. | C14H18ClN5O4S2 |
Mol. Mass. | 419.907 |
SMILES | Cn1nnnc1SCC1=C(N2C([C@@H](Cl)C2=O)S(=O)(=O)C1)C(=O)C(C)(C)C |t:9| |
Structure |
|