Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDOPAMINE
LigandBDBM50022053
Substrate/Competitorn/a
Meas. Tech.ChEMBL_58524
Ki 174±n/a nM
Citation Minor DLWyrick SDCharifson PSWatts VJNichols DEMailman RB Synthesis and molecular modeling of 1-phenyl-1,2,3,4-tetrahydroisoquinolines and related 5,6,8,9-tetrahydro-13bH-dibenzo[a,h]quinolizines as D1 dopamine antagonists. J Med Chem 37:4317-28 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
DOPAMINE
Name:Dopamine receptors; D1 & D2
Synonyms:D(1A) dopamine receptor | DOPAMINE D1 | Dopamine D1 high | Dopamine D1 low | Dopamine receptor | Dopamine receptor D1 | Dopamine1-like
Type:Enzyme Catalytic Domain
Mol. Mass.:49429.75
Organism:RAT
Description:DOPAMINE 0 RAT::P18901
Residue:446
Sequence:
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED
TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN
CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS
EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022053
n/a
NameBDBM50022053
Synonyms:1-Benzyl-6-chloro-2-methyl-1,2,3,4-tetrahydro-isoquinolin-7-ol | 7-Chloro-2-methyl-4-phenyl-1,2,3,4-tetrahydro-isoquinolin-6-ol | CHEMBL299056
TypeSmall organic molecule
Emp. Form.C16H16ClNO
Mol. Mass.273.757
SMILESCN1CC(c2ccccc2)c2cc(O)c(Cl)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: