| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50038410 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_138740 (CHEMBL747762) |
|---|
| Ki | >10000±n/a nM |
|---|
| Citation |  Mosberg, HI; Omnaas, JR; Lomize, A; Heyl, DL; Nordan, I; Mousigian, C; Davis, P; Porreca, F Development of a model for the delta opioid receptor pharmacophore. 2. Conformationally restricted Phe3 replacements in the cyclic delta receptor selective tetrapeptide Tyr-c[D-Cys-Phe-D-Pen]OH (JOM-13). J Med Chem37:4384-91 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50038410 |
|---|
| n/a |
|---|
| Name | BDBM50038410 |
|---|
| Synonyms: | 4-[2-Amino-3-(4-hydroxy-phenyl)-propionyl]-9-benzyl-3-mercaptomethyl-6-(1-mercapto-1-methyl-ethyl)-1-methyl-[1,4,7]triazonane-2,5,8-trione | CHEMBL2370834 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H34N4O5S2 |
|---|
| Mol. Mass. | 558.713 |
|---|
| SMILES | CN1[C@@H](Cc2ccccc2)C(=O)N[C@@H](C(=O)N([C@@H](CS)C1=O)C(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)(C)S |r| |
|---|
| Structure | 
|
|---|
Search and Browse
