Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM81982 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201876 (CHEMBL807239) |
---|
Ki | 60±n/a nM |
---|
Citation | John, CS; Vilner, BJ; Bowen, WD Synthesis and characterization of [125I]-N-(N-benzylpiperidin-4-yl)-4- iodobenzamide, a new sigma receptor radiopharmaceutical: high-affinity binding to MCF-7 breast tumor cells. J Med Chem37:1737-9 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM81982 |
---|
n/a |
---|
Name | BDBM81982 |
Synonyms: | CAS_97-39-2 | DITOLYLGUANIDINE | DTG | Di-o-tolylguanidine | Tol2Gdn | cid_7333 |
Type | Small organic molecule |
Emp. Form. | C15H17N3 |
Mol. Mass. | 239.3156 |
SMILES | Cc1ccccc1NC(N)=Nc1ccccc1C |w:10.11| |
Structure |
|