| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50387886 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1277545 (CHEMBL3096229) |
|---|
| Ki | 459±n/a nM |
|---|
| Citation |  Hollinshead, SP; Tidwell, MW; Palmer, J; Guidetti, R; Sanderson, A; Johnson, MP; Chambers, MG; Oskins, J; Stratford, R; Astles, PC Selective cannabinoid receptor type 2 (CB2) agonists: optimization of a series of purines leading to the identification of a clinical candidate for the treatment of osteoarthritic pain. J Med Chem56:5722-33 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CNR2_RAT | Cannabinoid CB2 receptor | Cannabinoid receptor | Cnr2 | rCB2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39366.68 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q9QZN9 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
|
|
|
|---|
| BDBM50387886 |
|---|
| n/a |
|---|
| Name | BDBM50387886 |
|---|
| Synonyms: | CHEMBL2057805 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H28ClN7O |
|---|
| Mol. Mass. | 453.968 |
|---|
| SMILES | CN1CCN(CC1)c1nc(C)nc2n(CCN3CCCC3=O)c(nc12)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
