| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50494706 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1280662 (CHEMBL3097103) |
|---|
| Ki | 0.150000±n/a nM |
|---|
| Citation |  Motel, WC; Healy, JR; Viard, E; Pouw, B; Martin, K; Matsumoto, RR; Coop, A Chlorophenylpiperazine analogues as high affinity dopamine transporter ligands. Bioorg Med Chem Lett23:6920-6922 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50494706 |
|---|
| n/a |
|---|
| Name | BDBM50494706 |
|---|
| Synonyms: | CHEMBL3093268 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H21ClN2 |
|---|
| Mol. Mass. | 300.826 |
|---|
| SMILES | Clc1ccccc1N1CCN(CCc2ccccc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
