| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50031870 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_52835 |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Gangjee, A; Shi, J; Queener, SF; Barrows, LR; Kisliuk, RL Synthesis of 5-methyl-5-deaza nonclassical antifolates as inhibitors of dihydrofolate reductases and as potential antipneumocystis, antitoxoplasma, and antitumor agents. J Med Chem36:3437-43 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM50031870 |
|---|
| n/a |
|---|
| Name | BDBM50031870 |
|---|
| Synonyms: | 6-{[(3,4-Dichloro-phenyl)-methyl-amino]-methyl}-5-methyl-pyrido[2,3-d]pyrimidine-2,4-diamine | CHEMBL82975 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16Cl2N6 |
|---|
| Mol. Mass. | 363.244 |
|---|
| SMILES | CN(Cc1cnc2nc(N)nc(N)c2c1C)c1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
