| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 1 |
|---|
| Ligand | BDBM85330 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_218511 |
|---|
| Ki | >10000±n/a nM |
|---|
| Citation |  van Wijngaarden, I; Hamminga, D; van Hes, R; Standaar, PJ; Tipker, J; Tulp, MT; Mol, F; Olivier, B; de Jonge, A Development of high-affinity 5-HT3 receptor antagonists. Structure-affinity relationships of novel 1,7-annelated indole derivatives. J Med Chem36:3693-9 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 1 |
|---|
| Name: | Leukotriene B4 receptor 1 |
|---|
| Synonyms: | Blt | LT4R1_RAT | LTB4-R 1 | Leukotriene B4 | Leukotriene B4 receptor 1 | Ltb4r |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37956.07 |
|---|
| Organism: | RAT |
|---|
| Description: | Leukotriene B4 0 RAT::Q9R0Q2 |
|---|
| Residue: | 351 |
|---|
| Sequence: | MAANTTSTAATSSPGGMSLSLLPIVLLSVALVVGLPGNSFVVWSILKRMQKRSVTALLVL
NLALADLAVLLTAPFFLHFLARGTWSFEVTGCRLCHYVCGVSMYASVLLITIMSLDRSLA
VARPFVSQKVRTKAFARWVLAGIWVVSFLLAIPVLVYRTVTPKNKTLICDSRYPSDGHKV
FHLLFEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHL
VNLVEAGRTLAGWDKNSPAGQRLKLARYVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VVKLLEGTGSEVSSTRRGGTLVQTPKATPTCPEPGPTDSFMTSSTPPESSK
|
|
|
|---|
| BDBM85330 |
|---|
| n/a |
|---|
| Name | BDBM85330 |
|---|
| Synonyms: | CAS_68647 | NSC_68647 | ONDANSETRON | Ondansetron hydrochloride |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19N3O |
|---|
| Mol. Mass. | 293.363 |
|---|
| SMILES | Cc1nccn1CC1CCc2c(C1=O)c1ccccc1n2C |
|---|
| Structure | 
|
|---|
Search and Browse
