| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50231569 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_217861 (CHEMBL822184) |
|---|
| Ki | >10000±n/a nM |
|---|
| Citation |  van Wijngaarden, I; Hamminga, D; van Hes, R; Standaar, PJ; Tipker, J; Tulp, MT; Mol, F; Olivier, B; de Jonge, A Development of high-affinity 5-HT3 receptor antagonists. Structure-affinity relationships of novel 1,7-annelated indole derivatives. J Med Chem36:3693-9 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50231569 |
|---|
| n/a |
|---|
| Name | BDBM50231569 |
|---|
| Synonyms: | Cilansetron | KC-9946 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H21N3O |
|---|
| Mol. Mass. | 319.4002 |
|---|
| SMILES | Cc1nccn1C[C@H]1CCc2c(C1=O)c1cccc3CCCn2c13 |
|---|
| Structure | 
|
|---|
Search and Browse
