| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Ligand | BDBM50496771 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1332680 (CHEMBL3224262) |
|---|
| IC50 | 797300±n/a nM |
|---|
| Citation |  Bitok, JK; Meyers, CF Synthesis and evaluation of stable substrate analogs as potential modulators of cyclodiphosphate synthase IspF. Medchemcomm4:130-134 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Synonyms: | 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase (IspF) | ISPF_ECOLI | MECDP-synthase | MECPS | ispF | mecS | ygbB |
|---|
| Type: | Homotrimer |
|---|
| Mol. Mass.: | 16897.34 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | P62617 |
|---|
| Residue: | 159 |
|---|
| Sequence: | MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
|
|
|
|---|
| BDBM50496771 |
|---|
| n/a |
|---|
| Name | BDBM50496771 |
|---|
| Synonyms: | CHEMBL3220831 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H17N3O10P2 |
|---|
| Mol. Mass. | 401.2036 |
|---|
| SMILES | Nc1ccn([C@@H]2O[C@H](COP(O)(=O)CP(O)(O)=O)[C@@H](O)[C@H]2O)c(=O)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
