| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50291779 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1525190 (CHEMBL3635311) |
|---|
| Kd | 8740±n/a nM |
|---|
| Citation |  Srinivasan, B; Tonddast-Navaei, S; Skolnick, J Ligand binding studies, preliminary structure-activity relationship and detailed mechanistic characterization of 1-phenyl-6,6-dimethyl-1,3,5-triazine-2,4-diamine derivatives as inhibitors of Escherichia coli dihydrofolate reductase. Eur J Med Chem103:600-14 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50291779 |
|---|
| n/a |
|---|
| Name | BDBM50291779 |
|---|
| Synonyms: | 3-(4,6-Diamino-2,2-dimethyl-2H-[1,3,5]triazin-1-yl)-benzonitrile | CHEMBL268914 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H14N6 |
|---|
| Mol. Mass. | 242.2798 |
|---|
| SMILES | CC1(C)N=C(N)N=C(N)N1c1cccc(c1)C#N |t:3,6| |
|---|
| Structure | 
|
|---|
Search and Browse
