Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50048458
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29477
Ki 1.2±n/a nM
Citation van Rhee AMSiddiqi SMMelman NShi DPadgett WLDaly JWJacobson KA Tetrahydrobenzothiophenone derivatives as a novel class of adenosine receptor antagonists. J Med Chem 39:398-406 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048458
n/a
NameBDBM50048458
Synonyms:CHEMBL130162 | N-(2-Amino-ethyl)-2-[4-(6-oxo-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purin-8-yl)-phenoxy]-acetamide
TypeSmall organic molecule
Emp. Form.C21H30N6O3
Mol. Mass.414.5013
SMILESCCCN1CN(CCC)C(=O)c2[nH]c(nc12)-c1ccc(OCC(=O)NCCN)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: