| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM50048928 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212395 (CHEMBL873375) |
|---|
| IC50 | 5000±n/a nM |
|---|
| Citation |  Cottam, HB; Shih, H; Tehrani, LR; Wasson, DB; Carson, DA Substituted xanthines, pteridinediones, and related compounds as potential antiinflammatory agents. Synthesis and biological evaluation of inhibitors of tumor necrosis factor alpha. J Med Chem39:2-9 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM50048928 |
|---|
| n/a |
|---|
| Name | BDBM50048928 |
|---|
| Synonyms: | 4-(2,4-Dioxo-1-propyl-1,4-dihydro-2H-pteridin-3-yl)-butyric acid ethyl ester | CHEMBL127042 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H20N4O4 |
|---|
| Mol. Mass. | 320.3437 |
|---|
| SMILES | CCCn1c2nccnc2c(=O)n(CCCC(=O)OCC)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
