| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50051152 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_63975 (CHEMBL677601) |
|---|
| Ki | 22±n/a nM |
|---|
| Citation |  Edwards, PD; Andisik, DW; Strimpler, AM; Gomes, B; Tuthill, PA Nonpeptidic inhibitors of human neutrophil elastase. 7. Design, synthesis, and in vitro activity of a series of pyridopyrimidine trifluoromethyl ketones. J Med Chem39:1112-24 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50051152 |
|---|
| n/a |
|---|
| Name | BDBM50051152 |
|---|
| Synonyms: | 2-((R)-3-Methylcarbamoylmethyl-2,4,8-trioxo-6-phenyl-2,3,4,8-tetrahydro-1H-pyrido[3,4-d]pyrimidin-7-yl)-N-(3,3,3-trifluoro-1-isopropyl-2-oxo-propyl)-acetamide | CHEMBL268005 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24F3N5O6 |
|---|
| Mol. Mass. | 535.4725 |
|---|
| SMILES | CNC(=O)Cn1c(=O)[nH]c2c(cc(-c3ccccc3)n(CC(=O)NC(C(C)C)C(=O)C(F)(F)F)c2=O)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
