Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50051910 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54740 (CHEMBL667191) |
---|
IC50 | 13±n/a nM |
---|
Citation | Gangjee, A; Vasudevan, A; Queener, SF; Kisliuk, RL 2,4-diamino-5-deaza-6-substituted pyrido[2,3-d]pyrimidine antifolates as potent and selective nonclassical inhibitors of dihydrofolate reductases. J Med Chem39:1438-46 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50051910 |
---|
n/a |
---|
Name | BDBM50051910 |
Synonyms: | (R)-4-Amino-5-(4-{[(2,4-diamino-pyrido[2,3-d]pyrimidin-6-yl)-methyl-amino]-methyl}-benzoylamino)-5-oxo-pentanoic acid | CHEMBL33815 |
Type | Small organic molecule |
Emp. Form. | C21H24N8O4 |
Mol. Mass. | 452.4665 |
SMILES | CN(Cc1ccc(cc1)C(=O)NC(=O)[C@H](N)CCC(O)=O)c1cnc2nc(N)nc(N)c2c1 |
Structure |
|